Anti LURAP1 pAb (ATL-HPA030061 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA030061-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: leucine rich adaptor protein 1
Gene Name: LURAP1
Alternative Gene Name: C1orf190, FLJ25163, LRAP35a
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028701: 95%, ENSRNOG00000023459: 95%
Entrez Gene ID: 541468
Uniprot ID: Q96LR2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GIEAVRWLLEERGTLTSHCSSLTSSQYSLTGGSPGRSRRGSWDSLPDTSTTDRLDSVSIGSFLDTVAPSELDEQGPP
Gene Sequence GIEAVRWLLEERGTLTSHCSSLTSSQYSLTGGSPGRSRRGSWDSLPDTSTTDRLDSVSIGSFLDTVAPSELDEQGPP
Gene ID - Mouse ENSMUSG00000028701
Gene ID - Rat ENSRNOG00000023459
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LURAP1 pAb (ATL-HPA030061 w/enhanced validation)
Datasheet Anti LURAP1 pAb (ATL-HPA030061 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti LURAP1 pAb (ATL-HPA030061 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti LURAP1 pAb (ATL-HPA030061 w/enhanced validation)
Datasheet Anti LURAP1 pAb (ATL-HPA030061 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti LURAP1 pAb (ATL-HPA030061 w/enhanced validation)