Anti LTK pAb (ATL-HPA059545)

Atlas Antibodies

Catalog No.: ATL-HPA059545-25

Protein Description: leukocyte receptor tyrosine kinase
Gene Name: LTK
Alternative Gene Name: TYK1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027297: 70%, ENSRNOG00000025130: 67%
Entrez Gene ID: 4058
Uniprot ID: P29376
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TQDPDVLNSLLPMELGPTPEEEGTSGLGNRSLECLRPPQPQELSPEKLKSWGGSPLGPWLSSGLKPLKS
• Gene Sequence: TQDPDVLNSLLPMELGPTPEEEGTSGLGNRSLECLRPPQPQELSPEKLKSWGGSPLGPWLSSGLKPLKS
• Gene ID - Mouse: ENSMUSG00000027297
• Gene ID - Rat: ENSRNOG00000025130
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.