Anti LTK pAb (ATL-HPA059545)
Atlas Antibodies
- Catalog No.:
- ATL-HPA059545-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: LTK
Alternative Gene Name: TYK1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027297: 70%, ENSRNOG00000025130: 67%
Entrez Gene ID: 4058
Uniprot ID: P29376
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TQDPDVLNSLLPMELGPTPEEEGTSGLGNRSLECLRPPQPQELSPEKLKSWGGSPLGPWLSSGLKPLKS |
| Gene Sequence | TQDPDVLNSLLPMELGPTPEEEGTSGLGNRSLECLRPPQPQELSPEKLKSWGGSPLGPWLSSGLKPLKS |
| Gene ID - Mouse | ENSMUSG00000027297 |
| Gene ID - Rat | ENSRNOG00000025130 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti LTK pAb (ATL-HPA059545) | |
| Datasheet | Anti LTK pAb (ATL-HPA059545) Datasheet (External Link) |
| Vendor Page | Anti LTK pAb (ATL-HPA059545) at Atlas Antibodies |
| Documents & Links for Anti LTK pAb (ATL-HPA059545) | |
| Datasheet | Anti LTK pAb (ATL-HPA059545) Datasheet (External Link) |
| Vendor Page | Anti LTK pAb (ATL-HPA059545) |