Anti LTK pAb (ATL-HPA059545)
Atlas Antibodies
- Catalog No.:
- ATL-HPA059545-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: LTK
Alternative Gene Name: TYK1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027297: 70%, ENSRNOG00000025130: 67%
Entrez Gene ID: 4058
Uniprot ID: P29376
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TQDPDVLNSLLPMELGPTPEEEGTSGLGNRSLECLRPPQPQELSPEKLKSWGGSPLGPWLSSGLKPLKS |
Gene Sequence | TQDPDVLNSLLPMELGPTPEEEGTSGLGNRSLECLRPPQPQELSPEKLKSWGGSPLGPWLSSGLKPLKS |
Gene ID - Mouse | ENSMUSG00000027297 |
Gene ID - Rat | ENSRNOG00000025130 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti LTK pAb (ATL-HPA059545) | |
Datasheet | Anti LTK pAb (ATL-HPA059545) Datasheet (External Link) |
Vendor Page | Anti LTK pAb (ATL-HPA059545) at Atlas Antibodies |
Documents & Links for Anti LTK pAb (ATL-HPA059545) | |
Datasheet | Anti LTK pAb (ATL-HPA059545) Datasheet (External Link) |
Vendor Page | Anti LTK pAb (ATL-HPA059545) |