Anti LTK pAb (ATL-HPA059545)

Atlas Antibodies

SKU:
ATL-HPA059545-25
  • Immunohistochemical staining of human tonsil shows moderate cytoplasmic positivity in subset of germinal center cells.
  • Immunofluorescent staining of human cell line RH-30 shows localization to vesicles.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: leukocyte receptor tyrosine kinase
Gene Name: LTK
Alternative Gene Name: TYK1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027297: 70%, ENSRNOG00000025130: 67%
Entrez Gene ID: 4058
Uniprot ID: P29376
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TQDPDVLNSLLPMELGPTPEEEGTSGLGNRSLECLRPPQPQELSPEKLKSWGGSPLGPWLSSGLKPLKS
Gene Sequence TQDPDVLNSLLPMELGPTPEEEGTSGLGNRSLECLRPPQPQELSPEKLKSWGGSPLGPWLSSGLKPLKS
Gene ID - Mouse ENSMUSG00000027297
Gene ID - Rat ENSRNOG00000025130
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti LTK pAb (ATL-HPA059545)
Datasheet Anti LTK pAb (ATL-HPA059545) Datasheet (External Link)
Vendor Page Anti LTK pAb (ATL-HPA059545) at Atlas Antibodies

Documents & Links for Anti LTK pAb (ATL-HPA059545)
Datasheet Anti LTK pAb (ATL-HPA059545) Datasheet (External Link)
Vendor Page Anti LTK pAb (ATL-HPA059545)