Anti LTBR pAb (ATL-HPA061617)

Atlas Antibodies

Catalog No.:
ATL-HPA061617-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: lymphotoxin beta receptor
Gene Name: LTBR
Alternative Gene Name: D12S370, TNF-R-III, TNFCR, TNFR-RP, TNFR2-RP, TNFRSF3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030339: 67%, ENSRNOG00000019264: 68%
Entrez Gene ID: 4055
Uniprot ID: P36941
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGT
Gene Sequence EAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGT
Gene ID - Mouse ENSMUSG00000030339
Gene ID - Rat ENSRNOG00000019264
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LTBR pAb (ATL-HPA061617)
Datasheet Anti LTBR pAb (ATL-HPA061617) Datasheet (External Link)
Vendor Page Anti LTBR pAb (ATL-HPA061617) at Atlas Antibodies

Documents & Links for Anti LTBR pAb (ATL-HPA061617)
Datasheet Anti LTBR pAb (ATL-HPA061617) Datasheet (External Link)
Vendor Page Anti LTBR pAb (ATL-HPA061617)