Anti LTB4R2 pAb (ATL-HPA072921)
Atlas Antibodies
- Catalog No.:
- ATL-HPA072921-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: LTB4R2
Alternative Gene Name: BLT2, BLTR2, JULF2, NOP9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040432: 74%, ENSRNOG00000020382: 80%
Entrez Gene ID: 56413
Uniprot ID: Q9NPC1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SREGTMELRTTPQLKVVGQGRGNGDPGGGMEKDGPEWDL |
Gene Sequence | SREGTMELRTTPQLKVVGQGRGNGDPGGGMEKDGPEWDL |
Gene ID - Mouse | ENSMUSG00000040432 |
Gene ID - Rat | ENSRNOG00000020382 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti LTB4R2 pAb (ATL-HPA072921) | |
Datasheet | Anti LTB4R2 pAb (ATL-HPA072921) Datasheet (External Link) |
Vendor Page | Anti LTB4R2 pAb (ATL-HPA072921) at Atlas Antibodies |
Documents & Links for Anti LTB4R2 pAb (ATL-HPA072921) | |
Datasheet | Anti LTB4R2 pAb (ATL-HPA072921) Datasheet (External Link) |
Vendor Page | Anti LTB4R2 pAb (ATL-HPA072921) |