Anti LTB4R2 pAb (ATL-HPA029680)

Atlas Antibodies

Catalog No.: ATL-HPA029680-25

Protein Description: leukotriene B4 receptor 2
Gene Name: LTB4R2
Alternative Gene Name: BLT2, BLTR2, JULF2, NOP9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025727: 38%, ENSRNOG00000020382: 37%
Entrez Gene ID: 56413
Uniprot ID: Q9NPC1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAPSHRASQVGFCPTPERPLWRLPPTCRPRRMSVCYRPPGNETLLSWKTSR
• Gene Sequence: MAPSHRASQVGFCPTPERPLWRLPPTCRPRRMSVCYRPPGNETLLSWKTSR
• Gene ID - Mouse: ENSMUSG00000025727
• Gene ID - Rat: ENSRNOG00000020382
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.