Anti LSS pAb (ATL-HPA032062)

Atlas Antibodies

Catalog No.:
ATL-HPA032062-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: lanosterol synthase (2,3-oxidosqualene-lanosterol cyclase)
Gene Name: LSS
Alternative Gene Name: OSC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033105: 77%, ENSRNOG00000054549: 79%
Entrez Gene ID: 4047
Uniprot ID: P48449
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MTEGTCLRRRGGPYKTEPATDLGRWRLNCERGRQTWTYLQDERAGREQTGLEAYALGLDTKNYFKDLPKAHTAFEGALNGMTF
Gene Sequence MTEGTCLRRRGGPYKTEPATDLGRWRLNCERGRQTWTYLQDERAGREQTGLEAYALGLDTKNYFKDLPKAHTAFEGALNGMTF
Gene ID - Mouse ENSMUSG00000033105
Gene ID - Rat ENSRNOG00000054549
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LSS pAb (ATL-HPA032062)
Datasheet Anti LSS pAb (ATL-HPA032062) Datasheet (External Link)
Vendor Page Anti LSS pAb (ATL-HPA032062) at Atlas Antibodies

Documents & Links for Anti LSS pAb (ATL-HPA032062)
Datasheet Anti LSS pAb (ATL-HPA032062) Datasheet (External Link)
Vendor Page Anti LSS pAb (ATL-HPA032062)