Anti LSR pAb (ATL-HPA075309)

Atlas Antibodies

Catalog No.:
ATL-HPA075309-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: lipolysis stimulated lipoprotein receptor
Gene Name: LSR
Alternative Gene Name: ILDR3, LISCH7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001247: 76%, ENSRNOG00000021053: 78%
Entrez Gene ID: 51599
Uniprot ID: Q86X29
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GVPSIYAPSTYAHLSPAKTPPPPAMIPMGPAYNGYPGGYPGDVDRSSSAGGQGSYVPLLRDTDSSVASEVRSGYRIQASQQDDSM
Gene Sequence GVPSIYAPSTYAHLSPAKTPPPPAMIPMGPAYNGYPGGYPGDVDRSSSAGGQGSYVPLLRDTDSSVASEVRSGYRIQASQQDDSM
Gene ID - Mouse ENSMUSG00000001247
Gene ID - Rat ENSRNOG00000021053
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LSR pAb (ATL-HPA075309)
Datasheet Anti LSR pAb (ATL-HPA075309) Datasheet (External Link)
Vendor Page Anti LSR pAb (ATL-HPA075309) at Atlas Antibodies

Documents & Links for Anti LSR pAb (ATL-HPA075309)
Datasheet Anti LSR pAb (ATL-HPA075309) Datasheet (External Link)
Vendor Page Anti LSR pAb (ATL-HPA075309)