Anti LSM2 pAb (ATL-HPA066718)
Atlas Antibodies
- Catalog No.:
- ATL-HPA066718-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: LSM2
Alternative Gene Name: C6orf28, G7b, YBL026W
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007050: 100%, ENSRNOG00000048725: 100%
Entrez Gene ID: 57819
Uniprot ID: Q9Y333
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ |
| Gene Sequence | KNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ |
| Gene ID - Mouse | ENSMUSG00000007050 |
| Gene ID - Rat | ENSRNOG00000048725 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti LSM2 pAb (ATL-HPA066718) | |
| Datasheet | Anti LSM2 pAb (ATL-HPA066718) Datasheet (External Link) |
| Vendor Page | Anti LSM2 pAb (ATL-HPA066718) at Atlas Antibodies |
| Documents & Links for Anti LSM2 pAb (ATL-HPA066718) | |
| Datasheet | Anti LSM2 pAb (ATL-HPA066718) Datasheet (External Link) |
| Vendor Page | Anti LSM2 pAb (ATL-HPA066718) |