Anti LSM2 pAb (ATL-HPA066718)

Atlas Antibodies

Catalog No.: ATL-HPA066718-25

Protein Description: LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae)
Gene Name: LSM2
Alternative Gene Name: C6orf28, G7b, YBL026W
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007050: 100%, ENSRNOG00000048725: 100%
Entrez Gene ID: 57819
Uniprot ID: Q9Y333
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ
• Gene Sequence: KNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ
• Gene ID - Mouse: ENSMUSG00000007050
• Gene ID - Rat: ENSRNOG00000048725
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.