Anti LSM2 pAb (ATL-HPA066718)

Atlas Antibodies

Catalog No.:
ATL-HPA066718-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae)
Gene Name: LSM2
Alternative Gene Name: C6orf28, G7b, YBL026W
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007050: 100%, ENSRNOG00000048725: 100%
Entrez Gene ID: 57819
Uniprot ID: Q9Y333
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ
Gene Sequence KNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ
Gene ID - Mouse ENSMUSG00000007050
Gene ID - Rat ENSRNOG00000048725
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LSM2 pAb (ATL-HPA066718)
Datasheet Anti LSM2 pAb (ATL-HPA066718) Datasheet (External Link)
Vendor Page Anti LSM2 pAb (ATL-HPA066718) at Atlas Antibodies

Documents & Links for Anti LSM2 pAb (ATL-HPA066718)
Datasheet Anti LSM2 pAb (ATL-HPA066718) Datasheet (External Link)
Vendor Page Anti LSM2 pAb (ATL-HPA066718)