Anti LSM14B pAb (ATL-HPA061189)
Atlas Antibodies
- Catalog No.:
- ATL-HPA061189-25
- Shipping:
- Calculated at Checkout
        
            
        
        
        $303.00
    
         
                            Gene Name: LSM14B
Alternative Gene Name: bA11M20.3, C20orf40, FAM61B, FLJ25473, FT005, LSM13, RAP55B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039108: 93%, ENSRNOG00000054557: 61%
Entrez Gene ID: 149986
Uniprot ID: Q9BX40
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC | 
| Reactivity | Human | 
| Clonality | Polyclonal | 
| Host | Rabbit | 
| Immunogen | SLGSASASPFQPHVPYSPFRGMAPYGPLAASSLLSQQYAASLGLGAGFPSIPVGKSPMVEQAVQTGSADNLNAK | 
| Gene Sequence | SLGSASASPFQPHVPYSPFRGMAPYGPLAASSLLSQQYAASLGLGAGFPSIPVGKSPMVEQAVQTGSADNLNAK | 
| Gene ID - Mouse | ENSMUSG00000039108 | 
| Gene ID - Rat | ENSRNOG00000054557 | 
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. | 
| Documents & Links for Anti LSM14B pAb (ATL-HPA061189) | |
| Datasheet | Anti LSM14B pAb (ATL-HPA061189) Datasheet (External Link) | 
| Vendor Page | Anti LSM14B pAb (ATL-HPA061189) at Atlas Antibodies | 
| Documents & Links for Anti LSM14B pAb (ATL-HPA061189) | |
| Datasheet | Anti LSM14B pAb (ATL-HPA061189) Datasheet (External Link) | 
| Vendor Page | Anti LSM14B pAb (ATL-HPA061189) | 
| Citations for Anti LSM14B pAb (ATL-HPA061189) – 1 Found | 
| Di Stefano, Bruno; Luo, En-Ching; Haggerty, Chuck; Aigner, Stefan; Charlton, Jocelyn; Brumbaugh, Justin; Ji, Fei; Rabano Jiménez, Inés; Clowers, Katie J; Huebner, Aaron J; Clement, Kendell; Lipchina, Inna; de Kort, Marit A C; Anselmo, Anthony; Pulice, John; Gerli, Mattia F M; Gu, Hongcang; Gygi, Steven P; Sadreyev, Ruslan I; Meissner, Alexander; Yeo, Gene W; Hochedlinger, Konrad. The RNA Helicase DDX6 Controls Cellular Plasticity by Modulating P-Body Homeostasis. Cell Stem Cell. 2019;25(5):622-638.e13. PubMed | 
 
         
                             
                                         
                                        