Anti LSM12 pAb (ATL-HPA051934)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051934-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: LSM12
Alternative Gene Name: FLJ30656
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020922: 100%, ENSRNOG00000020894: 100%
Entrez Gene ID: 124801
Uniprot ID: Q3MHD2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PGEYFSVGSQVSCRTCQEQRLQGEVVAFDYQSKMLALKCPSSSGKPNHADILLINLQYVSEVEIINDRTETPPPLASLNVSK |
Gene Sequence | PGEYFSVGSQVSCRTCQEQRLQGEVVAFDYQSKMLALKCPSSSGKPNHADILLINLQYVSEVEIINDRTETPPPLASLNVSK |
Gene ID - Mouse | ENSMUSG00000020922 |
Gene ID - Rat | ENSRNOG00000020894 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti LSM12 pAb (ATL-HPA051934) | |
Datasheet | Anti LSM12 pAb (ATL-HPA051934) Datasheet (External Link) |
Vendor Page | Anti LSM12 pAb (ATL-HPA051934) at Atlas Antibodies |
Documents & Links for Anti LSM12 pAb (ATL-HPA051934) | |
Datasheet | Anti LSM12 pAb (ATL-HPA051934) Datasheet (External Link) |
Vendor Page | Anti LSM12 pAb (ATL-HPA051934) |