Anti LSM11 pAb (ATL-HPA039587)

Atlas Antibodies

Catalog No.: ATL-HPA039587-25

Protein Description: LSM11, U7 small nuclear RNA associated
Gene Name: LSM11
Alternative Gene Name: FLJ38273
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044847: 99%, ENSRNOG00000005450: 99%
Entrez Gene ID: 134353
Uniprot ID: P83369
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RSVPSSLQASAREESRSELSGRTTRTDGSSVGGTFSRATTLSRGQSRKKKRKPKVDYQQVFTRHINQIFIRGENVLLV
• Gene Sequence: RSVPSSLQASAREESRSELSGRTTRTDGSSVGGTFSRATTLSRGQSRKKKRKPKVDYQQVFTRHINQIFIRGENVLLV
• Gene ID - Mouse: ENSMUSG00000044847
• Gene ID - Rat: ENSRNOG00000005450
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti LSM11 pAb (ATL-HPA039587) – 1 Found

Gadgil, Ankur; Walczak, Agnieszka; Stępień, Agata; Mechtersheimer, Jonas; Nishimura, Agnes Lumi; Shaw, Christopher E; Ruepp, Marc-David; Raczyńska, Katarzyna Dorota. ALS-linked FUS mutants affect the localization of U7 snRNP and replication-dependent histone gene expression in human cells. Scientific Reports. 2021;11(1):11868.