Anti LSM10 pAb (ATL-HPA048469 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA048469-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: LSM10, U7 small nuclear RNA associated
Gene Name: LSM10
Alternative Gene Name: MGC15749
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050188: 91%, ENSRNOG00000025716: 93%
Entrez Gene ID: 84967
Uniprot ID: Q969L4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GHQVKLDDLFVTGRNVRYVHIPDDVNITSTIEQQLQIIHRVRNFGGKGQGRWEFP
Gene Sequence GHQVKLDDLFVTGRNVRYVHIPDDVNITSTIEQQLQIIHRVRNFGGKGQGRWEFP
Gene ID - Mouse ENSMUSG00000050188
Gene ID - Rat ENSRNOG00000025716
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LSM10 pAb (ATL-HPA048469 w/enhanced validation)
Datasheet Anti LSM10 pAb (ATL-HPA048469 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti LSM10 pAb (ATL-HPA048469 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti LSM10 pAb (ATL-HPA048469 w/enhanced validation)
Datasheet Anti LSM10 pAb (ATL-HPA048469 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti LSM10 pAb (ATL-HPA048469 w/enhanced validation)