Anti LRTM2 pAb (ATL-HPA062745)

Atlas Antibodies

Catalog No.:
ATL-HPA062745-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: leucine rich repeats and transmembrane domains 2
Gene Name: LRTM2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055003: 94%, ENSRNOG00000007508: 94%
Entrez Gene ID: 654429
Uniprot ID: Q8N967
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EWFSYRGGRLDQLACTLPKELRGKDMRMVPMEMFNYCSQLEDENSSAGLDIPGPPCTKASPEPAKPKP
Gene Sequence EWFSYRGGRLDQLACTLPKELRGKDMRMVPMEMFNYCSQLEDENSSAGLDIPGPPCTKASPEPAKPKP
Gene ID - Mouse ENSMUSG00000055003
Gene ID - Rat ENSRNOG00000007508
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LRTM2 pAb (ATL-HPA062745)
Datasheet Anti LRTM2 pAb (ATL-HPA062745) Datasheet (External Link)
Vendor Page Anti LRTM2 pAb (ATL-HPA062745) at Atlas Antibodies

Documents & Links for Anti LRTM2 pAb (ATL-HPA062745)
Datasheet Anti LRTM2 pAb (ATL-HPA062745) Datasheet (External Link)
Vendor Page Anti LRTM2 pAb (ATL-HPA062745)