Anti LRTM2 pAb (ATL-HPA062745)

Atlas Antibodies

Catalog No.: ATL-HPA062745-25

Protein Description: leucine rich repeats and transmembrane domains 2
Gene Name: LRTM2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055003: 94%, ENSRNOG00000007508: 94%
Entrez Gene ID: 654429
Uniprot ID: Q8N967
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EWFSYRGGRLDQLACTLPKELRGKDMRMVPMEMFNYCSQLEDENSSAGLDIPGPPCTKASPEPAKPKP
• Gene Sequence: EWFSYRGGRLDQLACTLPKELRGKDMRMVPMEMFNYCSQLEDENSSAGLDIPGPPCTKASPEPAKPKP
• Gene ID - Mouse: ENSMUSG00000055003
• Gene ID - Rat: ENSRNOG00000007508
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.