Anti LRRTM3 pAb (ATL-HPA078598)

Atlas Antibodies

Catalog No.: ATL-HPA078598-25

Protein Description: leucine rich repeat transmembrane neuronal 3
Gene Name: LRRTM3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042846: 97%, ENSRNOG00000026466: 96%
Entrez Gene ID: 347731
Uniprot ID: Q86VH5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: STQEFYVDYKPTNTETSEMLLNGTGPCTYNKSGSRECEIPLSMNVSTFLAYDQPTISYCGVHHELLSHKSFETNAQEDTMETHLETELDL
• Gene Sequence: STQEFYVDYKPTNTETSEMLLNGTGPCTYNKSGSRECEIPLSMNVSTFLAYDQPTISYCGVHHELLSHKSFETNAQEDTMETHLETELDL
• Gene ID - Mouse: ENSMUSG00000042846
• Gene ID - Rat: ENSRNOG00000026466
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.