Anti LRRTM3 pAb (ATL-HPA078598)

Atlas Antibodies

Catalog No.:
ATL-HPA078598-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: leucine rich repeat transmembrane neuronal 3
Gene Name: LRRTM3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042846: 97%, ENSRNOG00000026466: 96%
Entrez Gene ID: 347731
Uniprot ID: Q86VH5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen STQEFYVDYKPTNTETSEMLLNGTGPCTYNKSGSRECEIPLSMNVSTFLAYDQPTISYCGVHHELLSHKSFETNAQEDTMETHLETELDL
Gene Sequence STQEFYVDYKPTNTETSEMLLNGTGPCTYNKSGSRECEIPLSMNVSTFLAYDQPTISYCGVHHELLSHKSFETNAQEDTMETHLETELDL
Gene ID - Mouse ENSMUSG00000042846
Gene ID - Rat ENSRNOG00000026466
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LRRTM3 pAb (ATL-HPA078598)
Datasheet Anti LRRTM3 pAb (ATL-HPA078598) Datasheet (External Link)
Vendor Page Anti LRRTM3 pAb (ATL-HPA078598) at Atlas Antibodies

Documents & Links for Anti LRRTM3 pAb (ATL-HPA078598)
Datasheet Anti LRRTM3 pAb (ATL-HPA078598) Datasheet (External Link)
Vendor Page Anti LRRTM3 pAb (ATL-HPA078598)