Anti LRRK2 pAb (ATL-HPA014293)

Atlas Antibodies

Catalog No.:
ATL-HPA014293-25
Shipping:
Calculated at Checkout
$351.00
Adding to cart… The item has been added
Protein Description: leucine-rich repeat kinase 2
Gene Name: LRRK2
Alternative Gene Name: DKFZp434H2111, FLJ45829, PARK8, RIPK7, ROCO2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036273: 91%, ENSRNOG00000004048: 91%
Entrez Gene ID: 120892
Uniprot ID: Q5S007
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VVGQLIPDCYVELEKIILSERKNVPIEFPVIDRKRLLQLVRENQLQLDENELPHAVHFLNESGVLLHFQDPALQLSDLYFVEPKWLCKIMAQILTVKVEGCPKHPKGIISRRDVEKFLSKKRKFPKNYMSQYFKLL
Gene Sequence VVGQLIPDCYVELEKIILSERKNVPIEFPVIDRKRLLQLVRENQLQLDENELPHAVHFLNESGVLLHFQDPALQLSDLYFVEPKWLCKIMAQILTVKVEGCPKHPKGIISRRDVEKFLSKKRKFPKNYMSQYFKLL
Gene ID - Mouse ENSMUSG00000036273
Gene ID - Rat ENSRNOG00000004048
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LRRK2 pAb (ATL-HPA014293)
Datasheet Anti LRRK2 pAb (ATL-HPA014293) Datasheet (External Link)
Vendor Page Anti LRRK2 pAb (ATL-HPA014293) at Atlas Antibodies

Documents & Links for Anti LRRK2 pAb (ATL-HPA014293)
Datasheet Anti LRRK2 pAb (ATL-HPA014293) Datasheet (External Link)
Vendor Page Anti LRRK2 pAb (ATL-HPA014293)
Citations for Anti LRRK2 pAb (ATL-HPA014293) – 1 Found
Jung, Kyungsoo; Choi, Joon-Seok; Koo, Beom-Mo; Kim, Yu Jin; Song, Ji-Young; Sung, Minjung; Chang, Eun Sol; Noh, Ka-Won; An, Sungbin; Lee, Mi-Sook; Song, Kyoung; Lee, Hannah; Kim, Ryong Nam; Shin, Young Kee; Oh, Doo-Yi; Choi, Yoon-La. TM4SF4 and LRRK2 Are Potential Therapeutic Targets in Lung and Breast Cancers through Outlier Analysis. Cancer Research And Treatment. 2021;53(1):9-24.  PubMed