Anti LRRK2 pAb (ATL-HPA014293)

Atlas Antibodies

Catalog No.: ATL-HPA014293-25

Protein Description: leucine-rich repeat kinase 2
Gene Name: LRRK2
Alternative Gene Name: DKFZp434H2111, FLJ45829, PARK8, RIPK7, ROCO2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036273: 91%, ENSRNOG00000004048: 91%
Entrez Gene ID: 120892
Uniprot ID: Q5S007
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VVGQLIPDCYVELEKIILSERKNVPIEFPVIDRKRLLQLVRENQLQLDENELPHAVHFLNESGVLLHFQDPALQLSDLYFVEPKWLCKIMAQILTVKVEGCPKHPKGIISRRDVEKFLSKKRKFPKNYMSQYFKLL
• Gene Sequence: VVGQLIPDCYVELEKIILSERKNVPIEFPVIDRKRLLQLVRENQLQLDENELPHAVHFLNESGVLLHFQDPALQLSDLYFVEPKWLCKIMAQILTVKVEGCPKHPKGIISRRDVEKFLSKKRKFPKNYMSQYFKLL
• Gene ID - Mouse: ENSMUSG00000036273
• Gene ID - Rat: ENSRNOG00000004048
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti LRRK2 pAb (ATL-HPA014293) – 1 Found

Jung, Kyungsoo; Choi, Joon-Seok; Koo, Beom-Mo; Kim, Yu Jin; Song, Ji-Young; Sung, Minjung; Chang, Eun Sol; Noh, Ka-Won; An, Sungbin; Lee, Mi-Sook; Song, Kyoung; Lee, Hannah; Kim, Ryong Nam; Shin, Young Kee; Oh, Doo-Yi; Choi, Yoon-La. TM4SF4 and LRRK2 Are Potential Therapeutic Targets in Lung and Breast Cancers through Outlier Analysis. Cancer Research And Treatment. 2021;53(1):9-24.