Anti LRRC72 pAb (ATL-HPA020554)

Atlas Antibodies

Catalog No.:
ATL-HPA020554-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: leucine rich repeat containing 72
Gene Name: LRRC72
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020545: 62%, ENSRNOG00000025049: 64%
Entrez Gene ID: 100506049
Uniprot ID: A6NJI9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SIAFGGKVDASWDPKSPFKQKPAQRVPSDFAFANNVDKTVLDDPEDAVFVRSMKRSVMTLTSMNWDTVPTREERYLEEEGTETAQMLTVT
Gene Sequence SIAFGGKVDASWDPKSPFKQKPAQRVPSDFAFANNVDKTVLDDPEDAVFVRSMKRSVMTLTSMNWDTVPTREERYLEEEGTETAQMLTVT
Gene ID - Mouse ENSMUSG00000020545
Gene ID - Rat ENSRNOG00000025049
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LRRC72 pAb (ATL-HPA020554)
Datasheet Anti LRRC72 pAb (ATL-HPA020554) Datasheet (External Link)
Vendor Page Anti LRRC72 pAb (ATL-HPA020554) at Atlas Antibodies

Documents & Links for Anti LRRC72 pAb (ATL-HPA020554)
Datasheet Anti LRRC72 pAb (ATL-HPA020554) Datasheet (External Link)
Vendor Page Anti LRRC72 pAb (ATL-HPA020554)