Anti LRRC69 pAb (ATL-HPA046337)

Atlas Antibodies

Catalog No.:
ATL-HPA046337-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: leucine rich repeat containing 69
Gene Name: LRRC69
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023151: 47%, ENSRNOG00000006498: 51%
Entrez Gene ID: 100130742
Uniprot ID: Q6ZNQ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LIKALSGGKNTKIITLNGKKMTKMPSALGKLPGLKTLVLQNNLIPKVCPELCNLTQFQDLKLREFYCEGNPLFLQQPVISTQQENVWSLQEIT
Gene Sequence LIKALSGGKNTKIITLNGKKMTKMPSALGKLPGLKTLVLQNNLIPKVCPELCNLTQFQDLKLREFYCEGNPLFLQQPVISTQQENVWSLQEIT
Gene ID - Mouse ENSMUSG00000023151
Gene ID - Rat ENSRNOG00000006498
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LRRC69 pAb (ATL-HPA046337)
Datasheet Anti LRRC69 pAb (ATL-HPA046337) Datasheet (External Link)
Vendor Page Anti LRRC69 pAb (ATL-HPA046337) at Atlas Antibodies

Documents & Links for Anti LRRC69 pAb (ATL-HPA046337)
Datasheet Anti LRRC69 pAb (ATL-HPA046337) Datasheet (External Link)
Vendor Page Anti LRRC69 pAb (ATL-HPA046337)