Anti LRRC66 pAb (ATL-HPA027839)

Atlas Antibodies

Catalog No.:
ATL-HPA027839-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: leucine rich repeat containing 66
Gene Name: LRRC66
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000067206: 66%, ENSRNOG00000026585: 58%
Entrez Gene ID: 339977
Uniprot ID: Q68CR7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QRNKLSDTPKGLWKLKSLQSLDLSFNGILQIGWSDFHNCLQLENLCLKSNKIFKIPPQAFKDLKKLQVIDLSNNALITILPMMIIALEFPHLVVDLADNNWQCDDSVAVFQNFISESWRKKWNVICNRSI
Gene Sequence QRNKLSDTPKGLWKLKSLQSLDLSFNGILQIGWSDFHNCLQLENLCLKSNKIFKIPPQAFKDLKKLQVIDLSNNALITILPMMIIALEFPHLVVDLADNNWQCDDSVAVFQNFISESWRKKWNVICNRSI
Gene ID - Mouse ENSMUSG00000067206
Gene ID - Rat ENSRNOG00000026585
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LRRC66 pAb (ATL-HPA027839)
Datasheet Anti LRRC66 pAb (ATL-HPA027839) Datasheet (External Link)
Vendor Page Anti LRRC66 pAb (ATL-HPA027839) at Atlas Antibodies

Documents & Links for Anti LRRC66 pAb (ATL-HPA027839)
Datasheet Anti LRRC66 pAb (ATL-HPA027839) Datasheet (External Link)
Vendor Page Anti LRRC66 pAb (ATL-HPA027839)