Anti LRRC63 pAb (ATL-HPA039763)

Atlas Antibodies

Catalog No.:
ATL-HPA039763-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: leucine rich repeat containing 63
Gene Name: LRRC63
Alternative Gene Name: RP11-139H14.4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021997: 40%, ENSRNOG00000038291: 47%
Entrez Gene ID: 220416
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TATLTLRVTEFPGFVSLPTPVLPRKPHRQSVIETLVTENGNIESVPKQIPPRPPEGLTKTEKIESEIHVVRGEGFKTVAATRYETITAMTNLAIVNCQVYGRN
Gene Sequence TATLTLRVTEFPGFVSLPTPVLPRKPHRQSVIETLVTENGNIESVPKQIPPRPPEGLTKTEKIESEIHVVRGEGFKTVAATRYETITAMTNLAIVNCQVYGRN
Gene ID - Mouse ENSMUSG00000021997
Gene ID - Rat ENSRNOG00000038291
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LRRC63 pAb (ATL-HPA039763)
Datasheet Anti LRRC63 pAb (ATL-HPA039763) Datasheet (External Link)
Vendor Page Anti LRRC63 pAb (ATL-HPA039763) at Atlas Antibodies

Documents & Links for Anti LRRC63 pAb (ATL-HPA039763)
Datasheet Anti LRRC63 pAb (ATL-HPA039763) Datasheet (External Link)
Vendor Page Anti LRRC63 pAb (ATL-HPA039763)