Anti LRRC63 pAb (ATL-HPA039763)

Atlas Antibodies

Catalog No.: ATL-HPA039763-25

Protein Description: leucine rich repeat containing 63
Gene Name: LRRC63
Alternative Gene Name: RP11-139H14.4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021997: 40%, ENSRNOG00000038291: 47%
Entrez Gene ID: 220416
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TATLTLRVTEFPGFVSLPTPVLPRKPHRQSVIETLVTENGNIESVPKQIPPRPPEGLTKTEKIESEIHVVRGEGFKTVAATRYETITAMTNLAIVNCQVYGRN
• Gene Sequence: TATLTLRVTEFPGFVSLPTPVLPRKPHRQSVIETLVTENGNIESVPKQIPPRPPEGLTKTEKIESEIHVVRGEGFKTVAATRYETITAMTNLAIVNCQVYGRN
• Gene ID - Mouse: ENSMUSG00000021997
• Gene ID - Rat: ENSRNOG00000038291
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.