Anti LRRC61 pAb (ATL-HPA019355 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA019355-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: leucine rich repeat containing 61
Gene Name: LRRC61
Alternative Gene Name: FLJ31392, HSPC295, MGC3036
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073096: 89%, ENSRNOG00000008234: 90%
Entrez Gene ID: 65999
Uniprot ID: Q9BV99
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ATCENLQSLNAAGNLLATPGQLQCLAGLPCLEYLRLRDPLARLSNPLCANPSYWAAVRELLPGLKVIDGERV
Gene Sequence ATCENLQSLNAAGNLLATPGQLQCLAGLPCLEYLRLRDPLARLSNPLCANPSYWAAVRELLPGLKVIDGERV
Gene ID - Mouse ENSMUSG00000073096
Gene ID - Rat ENSRNOG00000008234
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LRRC61 pAb (ATL-HPA019355 w/enhanced validation)
Datasheet Anti LRRC61 pAb (ATL-HPA019355 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti LRRC61 pAb (ATL-HPA019355 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti LRRC61 pAb (ATL-HPA019355 w/enhanced validation)
Datasheet Anti LRRC61 pAb (ATL-HPA019355 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti LRRC61 pAb (ATL-HPA019355 w/enhanced validation)