Anti LRRC6 pAb (ATL-HPA028058)

Atlas Antibodies

Catalog No.: ATL-HPA028058-25

Protein Description: leucine rich repeat containing 6
Gene Name: LRRC6
Alternative Gene Name: CILD19, LRTP, TSLRP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022375: 69%, ENSRNOG00000005233: 63%
Entrez Gene ID: 23639
Uniprot ID: Q86X45
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TTGHLVICMPKVGEVITGGQRAFKSMKTTSDRSREQTNTRSKHMEKLEVDPSKHSFPDVTNIVQEKKHTPRRRPEPKIIPSE
• Gene Sequence: TTGHLVICMPKVGEVITGGQRAFKSMKTTSDRSREQTNTRSKHMEKLEVDPSKHSFPDVTNIVQEKKHTPRRRPEPKIIPSE
• Gene ID - Mouse: ENSMUSG00000022375
• Gene ID - Rat: ENSRNOG00000005233
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti LRRC6 pAb (ATL-HPA028058) – 3 Found

Huizar, Ryan L; Lee, Chanjae; Boulgakov, Alexander A; Horani, Amjad; Tu, Fan; Marcotte, Edward M; Brody, Steven L; Wallingford, John B. A liquid-like organelle at the root of motile ciliopathy. Elife. 2018;7( 30561330) 

Horani, Amjad; Ferkol, Thomas W; Shoseyov, David; Wasserman, Mollie G; Oren, Yifat S; Kerem, Batsheva; Amirav, Israel; Cohen-Cymberknoh, Malena; Dutcher, Susan K; Brody, Steven L; Elpeleg, Orly; Kerem, Eitan. LRRC6 mutation causes primary ciliary dyskinesia with dynein arm defects. Plos One. 8(3):e59436. 

Liu, Zhen; Nguyen, Quynh P H; Guan, Qingxu; Albulescu, Alexandra; Erdman, Lauren; Mahdaviyeh, Yasaman; Kang, Jasmine; Ouyang, Hong; Hegele, Richard G; Moraes, Theo; Goldenberg, Anna; Dell, Sharon D; Mennella, Vito. A quantitative super-resolution imaging toolbox for diagnosis of motile ciliopathies. Science Translational Medicine. 2020;12(535)