Anti LRRC58 pAb (ATL-HPA057574)

Atlas Antibodies

Catalog No.: ATL-HPA057574-25

Protein Description: leucine rich repeat containing 58
Gene Name: LRRC58
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034158: 97%, ENSRNOG00000027151: 98%
Entrez Gene ID: 116064
Uniprot ID: Q96CX6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LSLGGNQLQSIPAEIENLQSLECLYLGGNFIKEIPPELGNLPSLNYLVLCDNKIQSIPPQLSQLHSLRSLSLHNNLLTYLPREILNLIHLEEL
• Gene Sequence: LSLGGNQLQSIPAEIENLQSLECLYLGGNFIKEIPPELGNLPSLNYLVLCDNKIQSIPPQLSQLHSLRSLSLHNNLLTYLPREILNLIHLEEL
• Gene ID - Mouse: ENSMUSG00000034158
• Gene ID - Rat: ENSRNOG00000027151
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.