Anti LRRC58 pAb (ATL-HPA057574)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057574-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: LRRC58
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034158: 97%, ENSRNOG00000027151: 98%
Entrez Gene ID: 116064
Uniprot ID: Q96CX6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LSLGGNQLQSIPAEIENLQSLECLYLGGNFIKEIPPELGNLPSLNYLVLCDNKIQSIPPQLSQLHSLRSLSLHNNLLTYLPREILNLIHLEEL |
| Gene Sequence | LSLGGNQLQSIPAEIENLQSLECLYLGGNFIKEIPPELGNLPSLNYLVLCDNKIQSIPPQLSQLHSLRSLSLHNNLLTYLPREILNLIHLEEL |
| Gene ID - Mouse | ENSMUSG00000034158 |
| Gene ID - Rat | ENSRNOG00000027151 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti LRRC58 pAb (ATL-HPA057574) | |
| Datasheet | Anti LRRC58 pAb (ATL-HPA057574) Datasheet (External Link) |
| Vendor Page | Anti LRRC58 pAb (ATL-HPA057574) at Atlas Antibodies |
| Documents & Links for Anti LRRC58 pAb (ATL-HPA057574) | |
| Datasheet | Anti LRRC58 pAb (ATL-HPA057574) Datasheet (External Link) |
| Vendor Page | Anti LRRC58 pAb (ATL-HPA057574) |