Anti LRRC57 pAb (ATL-HPA040894 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA040894-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: leucine rich repeat containing 57
Gene Name: LRRC57
Alternative Gene Name: FLJ36812
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027286: 95%, ENSRNOG00000048310: 94%
Entrez Gene ID: 255252
Uniprot ID: Q8N9N7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ESLPPLLIGKFTLLKSLSLNNNKLTVLPDEICNLKKLETLSLNNNHLRELPSTFGQLSALKTL
Gene Sequence ESLPPLLIGKFTLLKSLSLNNNKLTVLPDEICNLKKLETLSLNNNHLRELPSTFGQLSALKTL
Gene ID - Mouse ENSMUSG00000027286
Gene ID - Rat ENSRNOG00000048310
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LRRC57 pAb (ATL-HPA040894 w/enhanced validation)
Datasheet Anti LRRC57 pAb (ATL-HPA040894 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti LRRC57 pAb (ATL-HPA040894 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti LRRC57 pAb (ATL-HPA040894 w/enhanced validation)
Datasheet Anti LRRC57 pAb (ATL-HPA040894 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti LRRC57 pAb (ATL-HPA040894 w/enhanced validation)