Anti LRRC55 pAb (ATL-HPA014053)

Atlas Antibodies

Catalog No.:
ATL-HPA014053-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: leucine rich repeat containing 55
Gene Name: LRRC55
Alternative Gene Name: FLJ45686
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075224: 96%, ENSRNOG00000028266: 96%
Entrez Gene ID: 219527
Uniprot ID: Q6ZSA7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RLAHLDLSYNNFSHVPADMFQEAHGLVHIDLSHNPWLRRVHPQAFQGLMQLRDLDLSYGGLAFLSLEALEGLPGLVTLQIGGNPWVCGCTMEPLLKWLRNRIQRCTADSQ
Gene Sequence RLAHLDLSYNNFSHVPADMFQEAHGLVHIDLSHNPWLRRVHPQAFQGLMQLRDLDLSYGGLAFLSLEALEGLPGLVTLQIGGNPWVCGCTMEPLLKWLRNRIQRCTADSQ
Gene ID - Mouse ENSMUSG00000075224
Gene ID - Rat ENSRNOG00000028266
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LRRC55 pAb (ATL-HPA014053)
Datasheet Anti LRRC55 pAb (ATL-HPA014053) Datasheet (External Link)
Vendor Page Anti LRRC55 pAb (ATL-HPA014053) at Atlas Antibodies

Documents & Links for Anti LRRC55 pAb (ATL-HPA014053)
Datasheet Anti LRRC55 pAb (ATL-HPA014053) Datasheet (External Link)
Vendor Page Anti LRRC55 pAb (ATL-HPA014053)