Anti LRRC53 pAb (ATL-HPA054062)

Atlas Antibodies

Catalog No.:
ATL-HPA054062-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: leucine rich repeat containing 53
Gene Name: LRRC53
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051228: 29%, ENSRNOG00000009646: 29%
Entrez Gene ID: 105378803
Uniprot ID: A6NM62
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VDLSRNRLAHMPDVFTPLKQLILLSLDKNQWSCTCDLHPLARFLRNYIKSSAHTLRNAKDLNCQPSTAAVAAAQSVLRLSETNCDSKAPNFTLVL
Gene Sequence VDLSRNRLAHMPDVFTPLKQLILLSLDKNQWSCTCDLHPLARFLRNYIKSSAHTLRNAKDLNCQPSTAAVAAAQSVLRLSETNCDSKAPNFTLVL
Gene ID - Mouse ENSMUSG00000051228
Gene ID - Rat ENSRNOG00000009646
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LRRC53 pAb (ATL-HPA054062)
Datasheet Anti LRRC53 pAb (ATL-HPA054062) Datasheet (External Link)
Vendor Page Anti LRRC53 pAb (ATL-HPA054062) at Atlas Antibodies

Documents & Links for Anti LRRC53 pAb (ATL-HPA054062)
Datasheet Anti LRRC53 pAb (ATL-HPA054062) Datasheet (External Link)
Vendor Page Anti LRRC53 pAb (ATL-HPA054062)