Anti LRRC4C pAb (ATL-HPA075816)

Atlas Antibodies

Catalog No.:
ATL-HPA075816-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: leucine rich repeat containing 4C
Gene Name: LRRC4C
Alternative Gene Name: KIAA1580, NGL-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050587: 100%, ENSRNOG00000029798: 100%
Entrez Gene ID: 57689
Uniprot ID: Q9HCJ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NVDDEITGDTPMESHLPMPAIEHEHLNHYNSYKSPFNHTTTVNTINSIHSSVHEPLLIRMNSKD
Gene Sequence NVDDEITGDTPMESHLPMPAIEHEHLNHYNSYKSPFNHTTTVNTINSIHSSVHEPLLIRMNSKD
Gene ID - Mouse ENSMUSG00000050587
Gene ID - Rat ENSRNOG00000029798
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LRRC4C pAb (ATL-HPA075816)
Datasheet Anti LRRC4C pAb (ATL-HPA075816) Datasheet (External Link)
Vendor Page Anti LRRC4C pAb (ATL-HPA075816) at Atlas Antibodies

Documents & Links for Anti LRRC4C pAb (ATL-HPA075816)
Datasheet Anti LRRC4C pAb (ATL-HPA075816) Datasheet (External Link)
Vendor Page Anti LRRC4C pAb (ATL-HPA075816)