Anti LRRC45 pAb (ATL-HPA023382 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA023382-25

Protein Description: leucine rich repeat containing 45
Gene Name: LRRC45
Alternative Gene Name: MGC20806
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025145: 86%, ENSRNOG00000045926: 84%
Entrez Gene ID: 201255
Uniprot ID: Q96CN5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RTLWRLDLAGNNIPGDVLRAVEQAMGHSQDRLTTFQENQARTHVLSKEVQHLREEKSKQFLDLMETIDKQREEMAKSSRASAARV
• Gene Sequence: RTLWRLDLAGNNIPGDVLRAVEQAMGHSQDRLTTFQENQARTHVLSKEVQHLREEKSKQFLDLMETIDKQREEMAKSSRASAARV
• Gene ID - Mouse: ENSMUSG00000025145
• Gene ID - Rat: ENSRNOG00000045926
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.