Anti LRRC43 pAb (ATL-HPA047606)

Atlas Antibodies

Catalog No.:
ATL-HPA047606-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: leucine rich repeat containing 43
Gene Name: LRRC43
Alternative Gene Name: MGC35140
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063409: 66%, ENSRNOG00000008470: 65%
Entrez Gene ID: 254050
Uniprot ID: Q8N309
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LPAVDSPLSAKKGKGEKDKKGKEKDRTGKGEKEPAKEWKVLKKKKEPPKELRQDPPILQVLGRGLVILEPLLAGEPLVSTVCNFGVVRTLTSDRLTLARDSKKIKKVAK
Gene Sequence LPAVDSPLSAKKGKGEKDKKGKEKDRTGKGEKEPAKEWKVLKKKKEPPKELRQDPPILQVLGRGLVILEPLLAGEPLVSTVCNFGVVRTLTSDRLTLARDSKKIKKVAK
Gene ID - Mouse ENSMUSG00000063409
Gene ID - Rat ENSRNOG00000008470
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LRRC43 pAb (ATL-HPA047606)
Datasheet Anti LRRC43 pAb (ATL-HPA047606) Datasheet (External Link)
Vendor Page Anti LRRC43 pAb (ATL-HPA047606) at Atlas Antibodies

Documents & Links for Anti LRRC43 pAb (ATL-HPA047606)
Datasheet Anti LRRC43 pAb (ATL-HPA047606) Datasheet (External Link)
Vendor Page Anti LRRC43 pAb (ATL-HPA047606)