Anti LRRC43 pAb (ATL-HPA047606)

Atlas Antibodies

Catalog No.: ATL-HPA047606-25

Protein Description: leucine rich repeat containing 43
Gene Name: LRRC43
Alternative Gene Name: MGC35140
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063409: 66%, ENSRNOG00000008470: 65%
Entrez Gene ID: 254050
Uniprot ID: Q8N309
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LPAVDSPLSAKKGKGEKDKKGKEKDRTGKGEKEPAKEWKVLKKKKEPPKELRQDPPILQVLGRGLVILEPLLAGEPLVSTVCNFGVVRTLTSDRLTLARDSKKIKKVAK
• Gene Sequence: LPAVDSPLSAKKGKGEKDKKGKEKDRTGKGEKEPAKEWKVLKKKKEPPKELRQDPPILQVLGRGLVILEPLLAGEPLVSTVCNFGVVRTLTSDRLTLARDSKKIKKVAK
• Gene ID - Mouse: ENSMUSG00000063409
• Gene ID - Rat: ENSRNOG00000008470
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.