Anti LRRC42 pAb (ATL-HPA064581)
Atlas Antibodies
- Catalog No.:
- ATL-HPA064581-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: LRRC42
Alternative Gene Name: MGC8974
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028617: 88%, ENSRNOG00000009983: 91%
Entrez Gene ID: 115353
Uniprot ID: Q9Y546
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GIGYLFSFRKLNCLDISGTGLKDIKTVKHKLQTHIGLVHSKVPLKEFDHSNCKTEGWADQIVLQWERVTAEAVKPR |
Gene Sequence | GIGYLFSFRKLNCLDISGTGLKDIKTVKHKLQTHIGLVHSKVPLKEFDHSNCKTEGWADQIVLQWERVTAEAVKPR |
Gene ID - Mouse | ENSMUSG00000028617 |
Gene ID - Rat | ENSRNOG00000009983 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti LRRC42 pAb (ATL-HPA064581) | |
Datasheet | Anti LRRC42 pAb (ATL-HPA064581) Datasheet (External Link) |
Vendor Page | Anti LRRC42 pAb (ATL-HPA064581) at Atlas Antibodies |
Documents & Links for Anti LRRC42 pAb (ATL-HPA064581) | |
Datasheet | Anti LRRC42 pAb (ATL-HPA064581) Datasheet (External Link) |
Vendor Page | Anti LRRC42 pAb (ATL-HPA064581) |