Anti LRRC40 pAb (ATL-HPA026564)

Atlas Antibodies

Catalog No.: ATL-HPA026564-25

Protein Description: leucine rich repeat containing 40
Gene Name: LRRC40
Alternative Gene Name: FLJ20331
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063052: 80%, ENSRNOG00000011555: 81%
Entrez Gene ID: 55631
Uniprot ID: Q9H9A6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GNPLRTIRREIISKGTQEVLKYLRSKIKDDGPSQSESATETAMTLPSESRVNIHAIITLKILDYSDKQATLIPDEVFDAVKSNIVTSINF
• Gene Sequence: GNPLRTIRREIISKGTQEVLKYLRSKIKDDGPSQSESATETAMTLPSESRVNIHAIITLKILDYSDKQATLIPDEVFDAVKSNIVTSINF
• Gene ID - Mouse: ENSMUSG00000063052
• Gene ID - Rat: ENSRNOG00000011555
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.