Anti LRRC4 pAb (ATL-HPA051100)

Atlas Antibodies

Catalog No.:
ATL-HPA051100-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: leucine rich repeat containing 4
Gene Name: LRRC4
Alternative Gene Name: NAG14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049939: 100%, ENSRNOG00000008098: 100%
Entrez Gene ID: 64101
Uniprot ID: Q9HBW1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen APSGVSGEGAVVLPTIHDHINYNTYKPAHGAHWTENSLGNSLHPTVTTISEPYIIQTHTKDKVQE
Gene Sequence APSGVSGEGAVVLPTIHDHINYNTYKPAHGAHWTENSLGNSLHPTVTTISEPYIIQTHTKDKVQE
Gene ID - Mouse ENSMUSG00000049939
Gene ID - Rat ENSRNOG00000008098
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LRRC4 pAb (ATL-HPA051100)
Datasheet Anti LRRC4 pAb (ATL-HPA051100) Datasheet (External Link)
Vendor Page Anti LRRC4 pAb (ATL-HPA051100) at Atlas Antibodies

Documents & Links for Anti LRRC4 pAb (ATL-HPA051100)
Datasheet Anti LRRC4 pAb (ATL-HPA051100) Datasheet (External Link)
Vendor Page Anti LRRC4 pAb (ATL-HPA051100)