Anti LRRC3C pAb (ATL-HPA071271)

Atlas Antibodies

Catalog No.:
ATL-HPA071271-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: leucine rich repeat containing 3C
Gene Name: LRRC3C
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000086545: 79%, ENSRNOG00000031298: 79%
Entrez Gene ID: 100505591
Uniprot ID: A6NJW4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YVWQNRDETRRSLKRAPVLPVRSEDSSILSTVV
Gene Sequence YVWQNRDETRRSLKRAPVLPVRSEDSSILSTVV
Gene ID - Mouse ENSMUSG00000086545
Gene ID - Rat ENSRNOG00000031298
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LRRC3C pAb (ATL-HPA071271)
Datasheet Anti LRRC3C pAb (ATL-HPA071271) Datasheet (External Link)
Vendor Page Anti LRRC3C pAb (ATL-HPA071271) at Atlas Antibodies

Documents & Links for Anti LRRC3C pAb (ATL-HPA071271)
Datasheet Anti LRRC3C pAb (ATL-HPA071271) Datasheet (External Link)
Vendor Page Anti LRRC3C pAb (ATL-HPA071271)