Anti LRRC37A2 pAb (ATL-HPA049080)

Atlas Antibodies

Catalog No.:
ATL-HPA049080-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: leucine rich repeat containing 37, member A2
Gene Name: LRRC37A2
Alternative Gene Name: FLJ45049
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055994: 38%, ENSRNOG00000014124: 38%
Entrez Gene ID: 474170
Uniprot ID: A6NM11
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DEEGFSRGIFRFLPWRGCSSRRESQDGLSSFGQPLWFKD
Gene Sequence DEEGFSRGIFRFLPWRGCSSRRESQDGLSSFGQPLWFKD
Gene ID - Mouse ENSMUSG00000055994
Gene ID - Rat ENSRNOG00000014124
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LRRC37A2 pAb (ATL-HPA049080)
Datasheet Anti LRRC37A2 pAb (ATL-HPA049080) Datasheet (External Link)
Vendor Page Anti LRRC37A2 pAb (ATL-HPA049080) at Atlas Antibodies

Documents & Links for Anti LRRC37A2 pAb (ATL-HPA049080)
Datasheet Anti LRRC37A2 pAb (ATL-HPA049080) Datasheet (External Link)
Vendor Page Anti LRRC37A2 pAb (ATL-HPA049080)