Anti LRRC32 pAb (ATL-HPA058434)
Atlas Antibodies
- Catalog No.:
- ATL-HPA058434-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: LRRC32
Alternative Gene Name: D11S833E, GARP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090958: 94%, ENSRNOG00000015310: 96%
Entrez Gene ID: 2615
Uniprot ID: Q14392
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GNPLSCCGNGWLAAQLHQGRVDVDATQDLICRFSSQEEVSLSHVRPEDCEK |
| Gene Sequence | GNPLSCCGNGWLAAQLHQGRVDVDATQDLICRFSSQEEVSLSHVRPEDCEK |
| Gene ID - Mouse | ENSMUSG00000090958 |
| Gene ID - Rat | ENSRNOG00000015310 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti LRRC32 pAb (ATL-HPA058434) | |
| Datasheet | Anti LRRC32 pAb (ATL-HPA058434) Datasheet (External Link) |
| Vendor Page | Anti LRRC32 pAb (ATL-HPA058434) at Atlas Antibodies |
| Documents & Links for Anti LRRC32 pAb (ATL-HPA058434) | |
| Datasheet | Anti LRRC32 pAb (ATL-HPA058434) Datasheet (External Link) |
| Vendor Page | Anti LRRC32 pAb (ATL-HPA058434) |