Anti LRRC32 pAb (ATL-HPA058434)

Atlas Antibodies

Catalog No.:
ATL-HPA058434-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: leucine rich repeat containing 32
Gene Name: LRRC32
Alternative Gene Name: D11S833E, GARP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090958: 94%, ENSRNOG00000015310: 96%
Entrez Gene ID: 2615
Uniprot ID: Q14392
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GNPLSCCGNGWLAAQLHQGRVDVDATQDLICRFSSQEEVSLSHVRPEDCEK
Gene Sequence GNPLSCCGNGWLAAQLHQGRVDVDATQDLICRFSSQEEVSLSHVRPEDCEK
Gene ID - Mouse ENSMUSG00000090958
Gene ID - Rat ENSRNOG00000015310
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LRRC32 pAb (ATL-HPA058434)
Datasheet Anti LRRC32 pAb (ATL-HPA058434) Datasheet (External Link)
Vendor Page Anti LRRC32 pAb (ATL-HPA058434) at Atlas Antibodies

Documents & Links for Anti LRRC32 pAb (ATL-HPA058434)
Datasheet Anti LRRC32 pAb (ATL-HPA058434) Datasheet (External Link)
Vendor Page Anti LRRC32 pAb (ATL-HPA058434)