Anti LRRC28 pAb (ATL-HPA066130)

Atlas Antibodies

Catalog No.:
ATL-HPA066130-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: leucine rich repeat containing 28
Gene Name: LRRC28
Alternative Gene Name: FLJ34269, FLJ45242, MGC24976
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030556: 97%, ENSRNOG00000023274: 99%
Entrez Gene ID: 123355
Uniprot ID: Q86X40
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KRNSLTSLPENLAQKLPNLVELYLHSNNIVVVPEAIGSLVKLQCLDLSDNALEIVCPEIGRLRALRHLRLANNQLQF
Gene Sequence KRNSLTSLPENLAQKLPNLVELYLHSNNIVVVPEAIGSLVKLQCLDLSDNALEIVCPEIGRLRALRHLRLANNQLQF
Gene ID - Mouse ENSMUSG00000030556
Gene ID - Rat ENSRNOG00000023274
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LRRC28 pAb (ATL-HPA066130)
Datasheet Anti LRRC28 pAb (ATL-HPA066130) Datasheet (External Link)
Vendor Page Anti LRRC28 pAb (ATL-HPA066130) at Atlas Antibodies

Documents & Links for Anti LRRC28 pAb (ATL-HPA066130)
Datasheet Anti LRRC28 pAb (ATL-HPA066130) Datasheet (External Link)
Vendor Page Anti LRRC28 pAb (ATL-HPA066130)