Anti LRRC27 pAb (ATL-HPA067395 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA067395-25

• 
• 

Protein Description: leucine rich repeat containing 27
Gene Name: LRRC27
Alternative Gene Name: KIAA1674
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000111011: 42%, ENSRNOG00000017538: 38%
Entrez Gene ID: 80313
Uniprot ID: Q9C0I9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NRKVPLNPPGKMKPSKEKSPQASKEMSALQERNLEEKIKQHVLQMREQRRFHGQAPLEEMRKAAEDLEIATELQDEVLKLKLGL
• Gene Sequence: NRKVPLNPPGKMKPSKEKSPQASKEMSALQERNLEEKIKQHVLQMREQRRFHGQAPLEEMRKAAEDLEIATELQDEVLKLKLGL
• Gene ID - Mouse: ENSMUSG00000111011
• Gene ID - Rat: ENSRNOG00000017538
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.