Anti LRRC24 pAb (ATL-HPA052250)

Atlas Antibodies

Catalog No.: ATL-HPA052250-25

Protein Description: leucine rich repeat containing 24
Gene Name: LRRC24
Alternative Gene Name: LRRC14OS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033707: 68%, ENSRNOG00000016204: 70%
Entrez Gene ID: 441381
Uniprot ID: Q50LG9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EGALFVNDYLDGPCTFAQLEELRDERGHEMFVINRSKPLFAEGPAEAPADCGPEQGAGPGLRVPPPVAYEIHC
• Gene Sequence: EGALFVNDYLDGPCTFAQLEELRDERGHEMFVINRSKPLFAEGPAEAPADCGPEQGAGPGLRVPPPVAYEIHC
• Gene ID - Mouse: ENSMUSG00000033707
• Gene ID - Rat: ENSRNOG00000016204
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.