Anti LRRC24 pAb (ATL-HPA052250)

Atlas Antibodies

Catalog No.:
ATL-HPA052250-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: leucine rich repeat containing 24
Gene Name: LRRC24
Alternative Gene Name: LRRC14OS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033707: 68%, ENSRNOG00000016204: 70%
Entrez Gene ID: 441381
Uniprot ID: Q50LG9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EGALFVNDYLDGPCTFAQLEELRDERGHEMFVINRSKPLFAEGPAEAPADCGPEQGAGPGLRVPPPVAYEIHC
Gene Sequence EGALFVNDYLDGPCTFAQLEELRDERGHEMFVINRSKPLFAEGPAEAPADCGPEQGAGPGLRVPPPVAYEIHC
Gene ID - Mouse ENSMUSG00000033707
Gene ID - Rat ENSRNOG00000016204
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LRRC24 pAb (ATL-HPA052250)
Datasheet Anti LRRC24 pAb (ATL-HPA052250) Datasheet (External Link)
Vendor Page Anti LRRC24 pAb (ATL-HPA052250) at Atlas Antibodies

Documents & Links for Anti LRRC24 pAb (ATL-HPA052250)
Datasheet Anti LRRC24 pAb (ATL-HPA052250) Datasheet (External Link)
Vendor Page Anti LRRC24 pAb (ATL-HPA052250)