Anti LRRC2 pAb (ATL-HPA064844)
Atlas Antibodies
- Catalog No.:
- ATL-HPA064844-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: LRRC2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032495: 92%, ENSRNOG00000030688: 92%
Entrez Gene ID: 79442
Uniprot ID: Q9BYS8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LKQVTFVDISANKFSSVPICVLRMSNLQWLDISSNNLTDLPQDIDRLEELQSFLLYKNKLTYLPYSMLNLKKLTLL |
Gene Sequence | LKQVTFVDISANKFSSVPICVLRMSNLQWLDISSNNLTDLPQDIDRLEELQSFLLYKNKLTYLPYSMLNLKKLTLL |
Gene ID - Mouse | ENSMUSG00000032495 |
Gene ID - Rat | ENSRNOG00000030688 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti LRRC2 pAb (ATL-HPA064844) | |
Datasheet | Anti LRRC2 pAb (ATL-HPA064844) Datasheet (External Link) |
Vendor Page | Anti LRRC2 pAb (ATL-HPA064844) at Atlas Antibodies |
Documents & Links for Anti LRRC2 pAb (ATL-HPA064844) | |
Datasheet | Anti LRRC2 pAb (ATL-HPA064844) Datasheet (External Link) |
Vendor Page | Anti LRRC2 pAb (ATL-HPA064844) |