Anti LRRC2 pAb (ATL-HPA064844)
Atlas Antibodies
- Catalog No.:
- ATL-HPA064844-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: LRRC2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032495: 92%, ENSRNOG00000030688: 92%
Entrez Gene ID: 79442
Uniprot ID: Q9BYS8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LKQVTFVDISANKFSSVPICVLRMSNLQWLDISSNNLTDLPQDIDRLEELQSFLLYKNKLTYLPYSMLNLKKLTLL |
| Gene Sequence | LKQVTFVDISANKFSSVPICVLRMSNLQWLDISSNNLTDLPQDIDRLEELQSFLLYKNKLTYLPYSMLNLKKLTLL |
| Gene ID - Mouse | ENSMUSG00000032495 |
| Gene ID - Rat | ENSRNOG00000030688 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti LRRC2 pAb (ATL-HPA064844) | |
| Datasheet | Anti LRRC2 pAb (ATL-HPA064844) Datasheet (External Link) |
| Vendor Page | Anti LRRC2 pAb (ATL-HPA064844) at Atlas Antibodies |
| Documents & Links for Anti LRRC2 pAb (ATL-HPA064844) | |
| Datasheet | Anti LRRC2 pAb (ATL-HPA064844) Datasheet (External Link) |
| Vendor Page | Anti LRRC2 pAb (ATL-HPA064844) |