Anti LRRC17 pAb (ATL-HPA073458)

Atlas Antibodies

Catalog No.: ATL-HPA073458-25

Protein Description: leucine rich repeat containing 17
Gene Name: LRRC17
Alternative Gene Name: H_RG318M05.3, P37NB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039883: 88%, ENSRNOG00000012817: 88%
Entrez Gene ID: 10234
Uniprot ID: Q8N6Y2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DYNIHYLYYWLKHHYNVHFNGLECKTPEEYKGWSVGKYIRSYYEECPKDKLPAYPESFDQDTEDDEWEKKHRDHTAKKQSVII
• Gene Sequence: DYNIHYLYYWLKHHYNVHFNGLECKTPEEYKGWSVGKYIRSYYEECPKDKLPAYPESFDQDTEDDEWEKKHRDHTAKKQSVII
• Gene ID - Mouse: ENSMUSG00000039883
• Gene ID - Rat: ENSRNOG00000012817
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.