Anti LRRC17 pAb (ATL-HPA073458)

Atlas Antibodies

Catalog No.:
ATL-HPA073458-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: leucine rich repeat containing 17
Gene Name: LRRC17
Alternative Gene Name: H_RG318M05.3, P37NB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039883: 88%, ENSRNOG00000012817: 88%
Entrez Gene ID: 10234
Uniprot ID: Q8N6Y2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DYNIHYLYYWLKHHYNVHFNGLECKTPEEYKGWSVGKYIRSYYEECPKDKLPAYPESFDQDTEDDEWEKKHRDHTAKKQSVII
Gene Sequence DYNIHYLYYWLKHHYNVHFNGLECKTPEEYKGWSVGKYIRSYYEECPKDKLPAYPESFDQDTEDDEWEKKHRDHTAKKQSVII
Gene ID - Mouse ENSMUSG00000039883
Gene ID - Rat ENSRNOG00000012817
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LRRC17 pAb (ATL-HPA073458)
Datasheet Anti LRRC17 pAb (ATL-HPA073458) Datasheet (External Link)
Vendor Page Anti LRRC17 pAb (ATL-HPA073458) at Atlas Antibodies

Documents & Links for Anti LRRC17 pAb (ATL-HPA073458)
Datasheet Anti LRRC17 pAb (ATL-HPA073458) Datasheet (External Link)
Vendor Page Anti LRRC17 pAb (ATL-HPA073458)