Anti LRRC1 pAb (ATL-HPA031604)

Atlas Antibodies

Catalog No.:
ATL-HPA031604-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: leucine rich repeat containing 1
Gene Name: LRRC1
Alternative Gene Name: dJ523E19.1, FLJ10775, FLJ11834, LANO
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032352: 99%, ENSRNOG00000005970: 96%
Entrez Gene ID: 55227
Uniprot ID: Q9BTT6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QSLPENIGNLYNLASLELRENLLTYLPDSLTQLRRLEELDLGNNEIYNLPESVGALLHLKDLWLDGNQLSELPQEIGNLKNLLCL
Gene Sequence QSLPENIGNLYNLASLELRENLLTYLPDSLTQLRRLEELDLGNNEIYNLPESVGALLHLKDLWLDGNQLSELPQEIGNLKNLLCL
Gene ID - Mouse ENSMUSG00000032352
Gene ID - Rat ENSRNOG00000005970
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LRRC1 pAb (ATL-HPA031604)
Datasheet Anti LRRC1 pAb (ATL-HPA031604) Datasheet (External Link)
Vendor Page Anti LRRC1 pAb (ATL-HPA031604) at Atlas Antibodies

Documents & Links for Anti LRRC1 pAb (ATL-HPA031604)
Datasheet Anti LRRC1 pAb (ATL-HPA031604) Datasheet (External Link)
Vendor Page Anti LRRC1 pAb (ATL-HPA031604)