Anti LRP8 pAb (ATL-HPA073031)

Atlas Antibodies

Catalog No.:
ATL-HPA073031-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: LDL receptor related protein 8
Gene Name: LRP8
Alternative Gene Name: APOER2, HSZ75190, LRP-8, MCI1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028613: 94%, ENSRNOG00000061499: 26%
Entrez Gene ID: 7804
Uniprot ID: Q14114
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HIGRTAQIGHVYPAAISSFDRPLWAEPCLGETREPEDPAPALKELFVLPGEPRSQLHQLPKNPLSELPVVKSKRVALSLEDDGLP
Gene Sequence HIGRTAQIGHVYPAAISSFDRPLWAEPCLGETREPEDPAPALKELFVLPGEPRSQLHQLPKNPLSELPVVKSKRVALSLEDDGLP
Gene ID - Mouse ENSMUSG00000028613
Gene ID - Rat ENSRNOG00000061499
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LRP8 pAb (ATL-HPA073031)
Datasheet Anti LRP8 pAb (ATL-HPA073031) Datasheet (External Link)
Vendor Page Anti LRP8 pAb (ATL-HPA073031) at Atlas Antibodies

Documents & Links for Anti LRP8 pAb (ATL-HPA073031)
Datasheet Anti LRP8 pAb (ATL-HPA073031) Datasheet (External Link)
Vendor Page Anti LRP8 pAb (ATL-HPA073031)