Anti LRP8 pAb (ATL-HPA073031)
Atlas Antibodies
- Catalog No.:
- ATL-HPA073031-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: LRP8
Alternative Gene Name: APOER2, HSZ75190, LRP-8, MCI1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028613: 94%, ENSRNOG00000061499: 26%
Entrez Gene ID: 7804
Uniprot ID: Q14114
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HIGRTAQIGHVYPAAISSFDRPLWAEPCLGETREPEDPAPALKELFVLPGEPRSQLHQLPKNPLSELPVVKSKRVALSLEDDGLP |
| Gene Sequence | HIGRTAQIGHVYPAAISSFDRPLWAEPCLGETREPEDPAPALKELFVLPGEPRSQLHQLPKNPLSELPVVKSKRVALSLEDDGLP |
| Gene ID - Mouse | ENSMUSG00000028613 |
| Gene ID - Rat | ENSRNOG00000061499 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti LRP8 pAb (ATL-HPA073031) | |
| Datasheet | Anti LRP8 pAb (ATL-HPA073031) Datasheet (External Link) |
| Vendor Page | Anti LRP8 pAb (ATL-HPA073031) at Atlas Antibodies |
| Documents & Links for Anti LRP8 pAb (ATL-HPA073031) | |
| Datasheet | Anti LRP8 pAb (ATL-HPA073031) Datasheet (External Link) |
| Vendor Page | Anti LRP8 pAb (ATL-HPA073031) |