Anti LRP8 pAb (ATL-HPA073031)

Atlas Antibodies

Catalog No.: ATL-HPA073031-25

Protein Description: LDL receptor related protein 8
Gene Name: LRP8
Alternative Gene Name: APOER2, HSZ75190, LRP-8, MCI1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028613: 94%, ENSRNOG00000061499: 26%
Entrez Gene ID: 7804
Uniprot ID: Q14114
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HIGRTAQIGHVYPAAISSFDRPLWAEPCLGETREPEDPAPALKELFVLPGEPRSQLHQLPKNPLSELPVVKSKRVALSLEDDGLP
• Gene Sequence: HIGRTAQIGHVYPAAISSFDRPLWAEPCLGETREPEDPAPALKELFVLPGEPRSQLHQLPKNPLSELPVVKSKRVALSLEDDGLP
• Gene ID - Mouse: ENSMUSG00000028613
• Gene ID - Rat: ENSRNOG00000061499
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.