Anti LRP1B pAb (ATL-HPA069094)

Atlas Antibodies

Catalog No.: ATL-HPA069094-25

Protein Description: low density lipoprotein receptor-related protein 1B
Gene Name: LRP1B
Alternative Gene Name: LRP-DIT, LRPDIT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049252: 95%, ENSRNOG00000039050: 56%
Entrez Gene ID: 53353
Uniprot ID: Q9NZR2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GGPSAFKLPHTAPPIYLNSDLKGPLTAGPTNYSNPVYAKLYMDGQNCRNSLGSVDERKELLPKK
• Gene Sequence: GGPSAFKLPHTAPPIYLNSDLKGPLTAGPTNYSNPVYAKLYMDGQNCRNSLGSVDERKELLPKK
• Gene ID - Mouse: ENSMUSG00000049252
• Gene ID - Rat: ENSRNOG00000039050
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.