Anti LRP1B pAb (ATL-HPA069094)

Atlas Antibodies

Catalog No.:
ATL-HPA069094-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: low density lipoprotein receptor-related protein 1B
Gene Name: LRP1B
Alternative Gene Name: LRP-DIT, LRPDIT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049252: 95%, ENSRNOG00000039050: 56%
Entrez Gene ID: 53353
Uniprot ID: Q9NZR2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GGPSAFKLPHTAPPIYLNSDLKGPLTAGPTNYSNPVYAKLYMDGQNCRNSLGSVDERKELLPKK
Gene Sequence GGPSAFKLPHTAPPIYLNSDLKGPLTAGPTNYSNPVYAKLYMDGQNCRNSLGSVDERKELLPKK
Gene ID - Mouse ENSMUSG00000049252
Gene ID - Rat ENSRNOG00000039050
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LRP1B pAb (ATL-HPA069094)
Datasheet Anti LRP1B pAb (ATL-HPA069094) Datasheet (External Link)
Vendor Page Anti LRP1B pAb (ATL-HPA069094) at Atlas Antibodies

Documents & Links for Anti LRP1B pAb (ATL-HPA069094)
Datasheet Anti LRP1B pAb (ATL-HPA069094) Datasheet (External Link)
Vendor Page Anti LRP1B pAb (ATL-HPA069094)