Anti LRIT3 pAb (ATL-HPA013454)

Atlas Antibodies

Catalog No.: ATL-HPA013454-25

Protein Description: leucine-rich repeat, immunoglobulin-like and transmembrane domains 3
Gene Name: LRIT3
Alternative Gene Name: CSNB1F, FIGLER4, FLJ44691
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000093865: 84%, ENSRNOG00000061097: 83%
Entrez Gene ID: 345193
Uniprot ID: Q3SXY7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NPWFCDCHISKMIELSKVVDPAIVLLDPLMTCSEPERLTGILFQRAELEHCLKPSVMTSATKIMSALGSNVLLRCDATGFPTPQITWTRSDSSPVNYTVIQESPEEGVRWSIMSLTGISSKDAGDYKCKAKNLAGMSEAVV
• Gene Sequence: NPWFCDCHISKMIELSKVVDPAIVLLDPLMTCSEPERLTGILFQRAELEHCLKPSVMTSATKIMSALGSNVLLRCDATGFPTPQITWTRSDSSPVNYTVIQESPEEGVRWSIMSLTGISSKDAGDYKCKAKNLAGMSEAVV
• Gene ID - Mouse: ENSMUSG00000093865
• Gene ID - Rat: ENSRNOG00000061097
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti LRIT3 pAb (ATL-HPA013454) – 1 Found

Das, Rueben G; Becker, Doreen; Jagannathan, Vidhya; Goldstein, Orly; Santana, Evelyn; Carlin, Kendall; Sudharsan, Raghavi; Leeb, Tosso; Nishizawa, Yuji; Kondo, Mineo; Aguirre, Gustavo D; Miyadera, Keiko. Genome-wide association study and whole-genome sequencing identify a deletion in LRIT3 associated with canine congenital stationary night blindness. Scientific Reports. 2019;9(1):14166.