Anti LRIG3 pAb (ATL-HPA010773)

Atlas Antibodies

Catalog No.: ATL-HPA010773-25

Protein Description: leucine-rich repeats and immunoglobulin-like domains 3
Gene Name: LRIG3
Alternative Gene Name: FLJ90440, KIAA3016
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020105: 69%, ENSRNOG00000007654: 68%
Entrez Gene ID: 121227
Uniprot ID: Q6UXM1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NLCLNKSSLDFSANPEPASVASSNSFMGTFGKALRRPHLDAYSSFGQPSDCQPRAFYLKAHSSPDLDSGSEEDGKERTDFQEENHICTFKQTLENYRTPN
• Gene Sequence: NLCLNKSSLDFSANPEPASVASSNSFMGTFGKALRRPHLDAYSSFGQPSDCQPRAFYLKAHSSPDLDSGSEEDGKERTDFQEENHICTFKQTLENYRTPN
• Gene ID - Mouse: ENSMUSG00000020105
• Gene ID - Rat: ENSRNOG00000007654
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.