Anti LRG1 pAb (ATL-HPA001888 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA001888-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: LRG1
Alternative Gene Name: LRG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037095: 63%, ENSRNOG00000049918: 61%
Entrez Gene ID: 116844
Uniprot ID: P02750
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TLSPKDCQVFRSDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLPANLLQGASKLQELHLSSNGLESLSPEFLRPVPQLRVLDLTRNALTGLPPGLFQASATLDTLVLKENQLEVLEVSWLHGLKALGHLDLSG |
| Gene Sequence | TLSPKDCQVFRSDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLPANLLQGASKLQELHLSSNGLESLSPEFLRPVPQLRVLDLTRNALTGLPPGLFQASATLDTLVLKENQLEVLEVSWLHGLKALGHLDLSG |
| Gene ID - Mouse | ENSMUSG00000037095 |
| Gene ID - Rat | ENSRNOG00000049918 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti LRG1 pAb (ATL-HPA001888 w/enhanced validation) | |
| Datasheet | Anti LRG1 pAb (ATL-HPA001888 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti LRG1 pAb (ATL-HPA001888 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti LRG1 pAb (ATL-HPA001888 w/enhanced validation) | |
| Datasheet | Anti LRG1 pAb (ATL-HPA001888 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti LRG1 pAb (ATL-HPA001888 w/enhanced validation) |
| Citations for Anti LRG1 pAb (ATL-HPA001888 w/enhanced validation) – 13 Found |
| Wang, Xiaomeng; Abraham, Sabu; McKenzie, Jenny A G; Jeffs, Natasha; Swire, Matthew; Tripathi, Vineeta B; Luhmann, Ulrich F O; Lange, Clemens A K; Zhai, Zhenhua; Arthur, Helen M; Bainbridge, James; Moss, Stephen E; Greenwood, John. LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling. Nature. 2013;499(7458):306-11. PubMed |
| Honda, Hiromi; Fujimoto, Minoru; Miyamoto, Shintaro; Ishikawa, Nobuhisa; Serada, Satoshi; Hattori, Noboru; Nomura, Shintaro; Kohno, Nobuoki; Yokoyama, Akihito; Naka, Tetsuji. Sputum Leucine-Rich Alpha-2 Glycoprotein as a Marker of Airway Inflammation in Asthma. Plos One. 11(9):e0162672. PubMed |
| Zhou, Ying; Zhang, Xintian; Zhang, Jingjing; Fang, Jingyuan; Ge, Zhizheng; Li, Xiaobo. LRG1 promotes proliferation and inhibits apoptosis in colorectal cancer cells via RUNX1 activation. Plos One. 12(4):e0175122. PubMed |
| Yamamoto, Masaaki; Takahashi, Tsuyoshi; Serada, Satoshi; Sugase, Takahito; Tanaka, Koji; Miyazaki, Yasuhiro; Makino, Tomoki; Kurokawa, Yukinori; Yamasaki, Makoto; Nakajima, Kiyokazu; Takiguchi, Shuji; Naka, Testsuji; Mori, Masaki; Doki, Yuichiro. Overexpression of leucine-rich α2-glycoprotein-1 is a prognostic marker and enhances tumor migration in gastric cancer. Cancer Science. 2017;108(10):2052-2060. PubMed |
| Zhang, Qian; Huang, Rui; Tang, Qingchao; Yu, Yang; Huang, Quanlong; Chen, Yinggang; Wang, Guiyu; Wang, Xishan. Leucine-rich alpha-2-glycoprotein-1 is up-regulated in colorectal cancer and is a tumor promoter. Oncotargets And Therapy. 11( 29785123):2745-2752. PubMed |
| Mundo, Lucia; Tosi, Gian Marco; Lazzi, Stefano; Pertile, Grazia; Parolini, Barbara; Neri, Giovanni; Posarelli, Matteo; De Benedetto, Elena; Bacci, Tommaso; Silvestri, Ennio; Siciliano, Maria Chiara; Barbera, Stefano; Orlandini, Maurizio; Greenwood, John; Moss, Stephen E; Galvagni, Federico. LRG1 Expression Is Elevated in the Eyes of Patients with Neovascular Age-Related Macular Degeneration. International Journal Of Molecular Sciences. 2021;22(16) PubMed |
| He, Yuliang; Tacconi, Carlotta; Dieterich, Lothar C; Kim, Jihye; Restivo, Gaetana; Gousopoulos, Epameinondas; Lindenblatt, Nicole; Levesque, Mitchell P; Claassen, Manfred; Detmar, Michael. Novel Blood Vascular Endothelial Subtype-Specific Markers in Human Skin Unearthed by Single-Cell Transcriptomic Profiling. Cells. 2022;11(7) PubMed |
| Yin, Guo Nan; Kim, Do-Kyun; Kang, Ji In; Im, Yebin; Lee, Dong Sun; Han, Ah-Reum; Ock, Jiyeon; Choi, Min-Ji; Kwon, Mi-Hye; Limanjaya, Anita; Jung, Saet-Byel; Yang, Jimin; Min, Kwang Wook; Yun, Jeongwon; Koh, Yongjun; Park, Jong-Eun; Hwang, Daehee; Suh, Jun-Kyu; Ryu, Ji-Kan; Kim, Ho Min. Latrophilin-2 is a novel receptor of LRG1 that rescues vascular and neurological abnormalities and restores diabetic erectile function. Experimental & Molecular Medicine. 2022;54(5):626-638. PubMed |
| Lindén, Mårten; Segersten, Ulrika; Runeson, Marcus; Wester, Kenneth; Busch, Christer; Pettersson, Ulf; Lind, Sara Bergström; Malmström, Per-Uno. Tumour expression of bladder cancer-associated urinary proteins. Bju International. 2013;112(3):407-15. PubMed |
| Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476. PubMed |
| Fujimoto, Minoru; Matsumoto, Tomoshige; Serada, Satoshi; Tsujimura, Yusuke; Hashimoto, Shoji; Yasutomi, Yasuhiro; Naka, Tetsuji. Leucine-rich alpha 2 glycoprotein is a new marker for active disease of tuberculosis. Scientific Reports. 2020;10(1):3384. PubMed |
| Kajimoto, Etsuko; Endo, Masayuki; Fujimoto, Minoru; Matsuzaki, Shinya; Fujii, Makoto; Yagi, Kazunobu; Kakigano, Aiko; Mimura, Kazuya; Tomimatsu, Takuji; Serada, Satoshi; Takeuchi, Makoto; Yoshino, Kiyoshi; Ueda, Yutaka; Kimura, Tadashi; Naka, Tetsuji. Evaluation of leucine-rich alpha-2 glycoprotein as a biomarker of fetal infection. Plos One. 15(11):e0242076. PubMed |
| Choi, Chan Hee J; Barr, William; Zaman, Samir; Model, Corey; Park, Annsea; Koenen, Mascha; Lin, Zeran; Szwed, Sarah K; Marchildon, Francois; Crane, Audrey; Carroll, Thomas S; Molina, Henrik; Cohen, Paul. LRG1 is an adipokine that promotes insulin sensitivity and suppresses inflammation. Elife. 2022;11( 36346018) PubMed |