Anti LRFN2 pAb (ATL-HPA076660 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA076660-25
  • Immunohistochemistry analysis in human cerebral cortex and liver tissues using Anti-LRFN2 antibody. Corresponding LRFN2 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line SH-SY5Y shows localization to vesicles.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: leucine rich repeat and fibronectin type III domain containing 2
Gene Name: LRFN2
Alternative Gene Name: FIGLER2, KIAA1246, SALM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040490: 95%, ENSRNOG00000011803: 97%
Entrez Gene ID: 57497
Uniprot ID: Q9ULH4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PWRIPPSAPRPKPSLDRLMGAFASLDLKSQRKEELLDSRTPAGRGAGTSARGHHSDREPLL
Gene Sequence PWRIPPSAPRPKPSLDRLMGAFASLDLKSQRKEELLDSRTPAGRGAGTSARGHHSDREPLL
Gene ID - Mouse ENSMUSG00000040490
Gene ID - Rat ENSRNOG00000011803
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti LRFN2 pAb (ATL-HPA076660 w/enhanced validation)
Datasheet Anti LRFN2 pAb (ATL-HPA076660 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti LRFN2 pAb (ATL-HPA076660 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti LRFN2 pAb (ATL-HPA076660 w/enhanced validation)
Datasheet Anti LRFN2 pAb (ATL-HPA076660 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti LRFN2 pAb (ATL-HPA076660 w/enhanced validation)