Anti LRCH3 pAb (ATL-HPA017299)

Atlas Antibodies

Catalog No.: ATL-HPA017299-25

Protein Description: leucine-rich repeats and calponin homology (CH) domain containing 3
Gene Name: LRCH3
Alternative Gene Name: MGC4126
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022801: 87%, ENSRNOG00000011141: 38%
Entrez Gene ID: 84859
Uniprot ID: Q96II8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NLCSPSDILQLNLSVKRTVETLLSLGAHSEESSFVCLSL
• Gene Sequence: NLCSPSDILQLNLSVKRTVETLLSLGAHSEESSFVCLSL
• Gene ID - Mouse: ENSMUSG00000022801
• Gene ID - Rat: ENSRNOG00000011141
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.