Anti LRBA pAb (ATL-HPA019366)

Atlas Antibodies

Catalog No.: ATL-HPA019366-25

Protein Description: LPS-responsive vesicle trafficking, beach and anchor containing
Gene Name: LRBA
Alternative Gene Name: BGL, CDC4L, LAB300, LBA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028080: 72%, ENSRNOG00000023453: 73%
Entrez Gene ID: 987
Uniprot ID: P50851
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SVLMVSKYRDILEPQNERHSQSCTETGSENENVSLSEITPAAFSTLTTASVEESESTSSARRRDSGIGEETATGLGSHVEVTPHTAPPGVSAGPDAISEVLSTLSLEVNKSPETKNDRGNDLDTKATPSVSV
• Gene Sequence: SVLMVSKYRDILEPQNERHSQSCTETGSENENVSLSEITPAAFSTLTTASVEESESTSSARRRDSGIGEETATGLGSHVEVTPHTAPPGVSAGPDAISEVLSTLSLEVNKSPETKNDRGNDLDTKATPSVSV
• Gene ID - Mouse: ENSMUSG00000028080
• Gene ID - Rat: ENSRNOG00000023453
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti LRBA pAb (ATL-HPA019366) – 3 Found

Burns, Siobhan O; Zenner, Helen L; Plagnol, Vincent; Curtis, James; Mok, Kin; Eisenhut, Michael; Kumararatne, Dinakantha; Doffinger, Rainer; Thrasher, Adrian J; Nejentsev, Sergey. LRBA gene deletion in a patient presenting with autoimmunity without hypogammaglobulinemia. The Journal Of Allergy And Clinical Immunology. 2012;130(6):1428-32. 

Gámez-Díaz, Laura; Sigmund, Elena C; Reiser, Veronika; Vach, Werner; Jung, Sophie; Grimbacher, Bodo. Rapid Flow Cytometry-Based Test for the Diagnosis of Lipopolysaccharide Responsive Beige-Like Anchor (LRBA) Deficiency. Frontiers In Immunology. 9( 29740429):720. 

Martínez-Jaramillo, Catalina; Gutierrez-Hincapie, Sebastian; Arango, Julio César Orrego; Vásquez-Duque, Gloria María; Erazo-Garnica, Ruth María; Franco, Jose Luis; Trujillo-Vargas, Claudia Milena. Clinical, immunological and genetic characteristic of patients with clinical phenotype associated to LRBA-deficiency in Colombia. Colombia Medica (Cali, Colombia). 2019;50(3):176-191.