Anti LPO pAb (ATL-HPA028688 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA028688-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: LPO
Alternative Gene Name: SPO
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000009356: 84%, ENSRNOG00000008422: 82%
Entrez Gene ID: 4025
Uniprot ID: P22079
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | IVGYLNEEGVLDQNRSLLFMQWGQIVDHDLDFAPDTELGSSEYSKAQCDEYCIQGDNCFPIMFPPNDPKAGTQGKCMPFFRAGFVCPTPPYKSLAR |
| Gene Sequence | IVGYLNEEGVLDQNRSLLFMQWGQIVDHDLDFAPDTELGSSEYSKAQCDEYCIQGDNCFPIMFPPNDPKAGTQGKCMPFFRAGFVCPTPPYKSLAR |
| Gene ID - Mouse | ENSMUSG00000009356 |
| Gene ID - Rat | ENSRNOG00000008422 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti LPO pAb (ATL-HPA028688 w/enhanced validation) | |
| Datasheet | Anti LPO pAb (ATL-HPA028688 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti LPO pAb (ATL-HPA028688 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti LPO pAb (ATL-HPA028688 w/enhanced validation) | |
| Datasheet | Anti LPO pAb (ATL-HPA028688 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti LPO pAb (ATL-HPA028688 w/enhanced validation) |
| Citations for Anti LPO pAb (ATL-HPA028688 w/enhanced validation) – 1 Found |
| Saitou, Marie; Gaylord, Eliza A; Xu, Erica; May, Alison J; Neznanova, Lubov; Nathan, Sara; Grawe, Anissa; Chang, Jolie; Ryan, William; Ruhl, Stefan; Knox, Sarah M; Gokcumen, Omer. Functional Specialization of Human Salivary Glands and Origins of Proteins Intrinsic to Human Saliva. Cell Reports. 2020;33(7):108402. PubMed |