Anti LPCAT1 pAb (ATL-HPA022268 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA022268-25

Protein Description: lysophosphatidylcholine acyltransferase 1
Gene Name: LPCAT1
Alternative Gene Name: AYTL2, FLJ12443
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021608: 89%, ENSRNOG00000017930: 89%
Entrez Gene ID: 79888
Uniprot ID: Q8NF37
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GVSVTDYTFEDCQLALAEGQLRLPADTCLLEFARLVRGLGLKPEKLEKDLDRYSERARMKGGEKIGIAEFAASLEVPVSDLLEDMFSLFDESGSGEVDLRECVVALSV
• Gene Sequence: GVSVTDYTFEDCQLALAEGQLRLPADTCLLEFARLVRGLGLKPEKLEKDLDRYSERARMKGGEKIGIAEFAASLEVPVSDLLEDMFSLFDESGSGEVDLRECVVALSV
• Gene ID - Mouse: ENSMUSG00000021608
• Gene ID - Rat: ENSRNOG00000017930
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti LPCAT1 pAb (ATL-HPA022268 w/enhanced validation) – 3 Found

Dai, Xufeng; Zhang, Hua; Han, Juanjuan; He, Ying; Zhang, Yangyang; Qi, Yan; Pang, Ji-Jing. Effects of Subretinal Gene Transfer at Different Time Points in a Mouse Model of Retinal Degeneration. Plos One. 11(5):e0156542. 

Friedman, James S; Chang, Bo; Krauth, Daniel S; Lopez, Irma; Waseem, Naushin H; Hurd, Ron E; Feathers, Kecia L; Branham, Kari E; Shaw, Manessa; Thomas, George E; Brooks, Matthew J; Liu, Chunqiao; Bakeri, Hirva A; Campos, Maria M; Maubaret, Cecilia; Webster, Andrew R; Rodriguez, Ignacio R; Thompson, Debra A; Bhattacharya, Shomi S; Koenekoop, Robert K; Heckenlively, John R; Swaroop, Anand. Loss of lysophosphatidylcholine acyltransferase 1 leads to photoreceptor degeneration in rd11 mice. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2010;107(35):15523-8. 

Dai, Xufeng; Han, Juanjuan; Qi, Yan; Zhang, Hua; Xiang, Lue; Lv, Jineng; Li, Jie; Deng, Wen-Tao; Chang, Bo; Hauswirth, William W; Pang, Ji-jing. AAV-mediated lysophosphatidylcholine acyltransferase 1 (Lpcat1) gene replacement therapy rescues retinal degeneration in rd11 mice. Investigative Ophthalmology & Visual Science. 2014;55(3):1724-34.